(data stored in ACNUC7421 zone)

EMBL: CP000031.THID

CP000031.THID        Location/Qualifiers
FT   CDS             46122..46925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SPO0045"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by similarity to SP:P76422; match to
FT                   protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93376"
FT                   /db_xref="GOA:Q5LWJ4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ4"
FT                   /protein_id="AAV93376.1"
FT                   /translation="MVPIALTIAGSDSGGGAGIQADLKAMSALGIYGASVITAVTAQNT
FT                   CAVTAVHEIPTEIIRAQIEAVLDDLDVRAIKIGMLATPEIIGAVADAIAGFDGPVVLDP
FT                   VMVAKSGDALLAAEAVASLKERLLPRATLLTPNLPEAARLLSLRDAADQDEMVSQARAL
FT                   IALGAEAVLMKGGHAKGAICHDLLVGRAGVLAEFSAPRRMTKNTHGTGCTLSSAIAAGL
FT                   AKGRTLKAAVRDAHTYLQGAIVAADRLGVGKGHGPVHHFHRVWSA"
     MVPIALTIAG SDSGGGAGIQ ADLKAMSALG IYGASVITAV TAQNTCAVTA VHEIPTEIIR        60
     AQIEAVLDDL DVRAIKIGML ATPEIIGAVA DAIAGFDGPV VLDPVMVAKS GDALLAAEAV       120
     ASLKERLLPR ATLLTPNLPE AARLLSLRDA ADQDEMVSQA RALIALGAEA VLMKGGHAKG       180
     AICHDLLVGR AGVLAEFSAP RRMTKNTHGT GCTLSSAIAA GLAKGRTLKA AVRDAHTYLQ       240
     GAIVAADRLG VGKGHGPVHH FHRVWSA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page