(data stored in ACNUC7421 zone)

EMBL: CP000031.UBIB

CP000031.UBIB        Location/Qualifiers
FT   CDS             complement(159233..160762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="SPO0144"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by similarity to SP:P27854; match to
FT                   protein family HMM PF03109; match to protein family HMM
FT                   TIGR01982"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93472"
FT                   /db_xref="GOA:Q5LWU1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU1"
FT                   /protein_id="AAV93472.1"
FT                   /translation="MRGPHNIIRLIRTGATLERNGAMAAVLDAFDAPRPLRILARALGK
FT                   PFQWLGFKGDPSLPPATRALMAMGPAYIKFGQVLSTRPDVVGQDLADQLRVLQDQLPPF
FT                   PRAVAMREVEKELGRPLPEMFSEFSEPIAAASIAQVHRARLADSGEDVAVKVLRPGIER
FT                   AFRKDVDAFYFAARIVDLFAPGARRLRPMEVIEHFDGVVRGELDLRLESAAASEFADNT
FT                   KEDAGFRLPPVRWSLSARRVMTLGWADGVPLGDNAALDAAGHNRRDLGERVLRLFLLHA
FT                   LRDGFFHADMHQGNLKVAADGDIIAYDFGIMGHIDEYTRRVYAEILFGFIRRDYKRVAE
FT                   VHFEAGYVPATQDVDEFARALRAVGEPIFGMDATHISMGRLLSYLFEVTERFGMETRTE
FT                   LILLQRTMVVVEGVARSLDPHINIWQVARPVVEDYIKQSIGPRAVLADLGKTALVVARF
FT                   GPRLPDLVERALVAQSQPGLVEKPGRSAAFWPALGGALIGGGVVLLASLFI"
     MRGPHNIIRL IRTGATLERN GAMAAVLDAF DAPRPLRILA RALGKPFQWL GFKGDPSLPP        60
     ATRALMAMGP AYIKFGQVLS TRPDVVGQDL ADQLRVLQDQ LPPFPRAVAM REVEKELGRP       120
     LPEMFSEFSE PIAAASIAQV HRARLADSGE DVAVKVLRPG IERAFRKDVD AFYFAARIVD       180
     LFAPGARRLR PMEVIEHFDG VVRGELDLRL ESAAASEFAD NTKEDAGFRL PPVRWSLSAR       240
     RVMTLGWADG VPLGDNAALD AAGHNRRDLG ERVLRLFLLH ALRDGFFHAD MHQGNLKVAA       300
     DGDIIAYDFG IMGHIDEYTR RVYAEILFGF IRRDYKRVAE VHFEAGYVPA TQDVDEFARA       360
     LRAVGEPIFG MDATHISMGR LLSYLFEVTE RFGMETRTEL ILLQRTMVVV EGVARSLDPH       420
     INIWQVARPV VEDYIKQSIG PRAVLADLGK TALVVARFGP RLPDLVERAL VAQSQPGLVE       480
     KPGRSAAFWP ALGGALIGGG VVLLASLFI                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page