(data stored in ACNUC7421 zone)

EMBL: CP000031.UBIE

CP000031.UBIE        Location/Qualifiers
FT   CDS             complement(160766..161539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="SPO0145"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /note="identified by similarity to SP:P27851; match to
FT                   protein family HMM PF01209; match to protein family HMM
FT                   TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93473"
FT                   /db_xref="GOA:Q5LWU0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU0"
FT                   /protein_id="AAV93473.1"
FT                   /translation="MRGTARPMSDRSDKTTHFGFETVPEHEKAGRVQGVFGSVASKYDV
FT                   MNDVMSMGIHRVWKDAMMDWLAPRPGQRLLDVAGGTGDISFRFLKRAGHGHATVLDLTE
FT                   PMLVEGRKRAEAERMADSLDWVVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAY
FT                   RVLRPGGRLMVLEFSQLPNDGLQKLYDLYSFNVIPRMGQLIANDSASYQYLVESIRNFP
FT                   NQETFLGMVQAAGFGNAKYRNLSMGIAALHSGWKI"
     MRGTARPMSD RSDKTTHFGF ETVPEHEKAG RVQGVFGSVA SKYDVMNDVM SMGIHRVWKD        60
     AMMDWLAPRP GQRLLDVAGG TGDISFRFLK RAGHGHATVL DLTEPMLVEG RKRAEAERMA       120
     DSLDWVVGDA MALPFEDNTF DVYTISFGIR NVTRPQEALN EAYRVLRPGG RLMVLEFSQL       180
     PNDGLQKLYD LYSFNVIPRM GQLIANDSAS YQYLVESIRN FPNQETFLGM VQAAGFGNAK       240
     YRNLSMGIAA LHSGWKI                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page