(data stored in ACNUC9435 zone)

EMBL: CP000031.UBIG

CP000031.UBIG        Location/Qualifiers
FT   CDS             70268..71014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="SPO0067"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="identified by similarity to SP:P17993; match to
FT                   protein family HMM TIGR01983"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93398"
FT                   /db_xref="GOA:Q5LWM6"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWM6"
FT                   /protein_id="AAV93398.1"
FT                   /translation="MQAHPNTVDPSEIAKFEAMAAEWWDPHGKFKPLHMLNPCRLDYIT
FT                   RQIAGEFDRDLGTERPFAGLRLLDIGCGGGLLSEPMARLGAEVVGADAAEGNLPVARIH
FT                   AEQSGLEIDYRHTTAEALAEAGEQFDVVLNMEVVEHVADPLSYLRATHDLLKPGGLQIC
FT                   STINRNPKSYAMAILGAEVVMRWLPRGTHDWSKFITPDELFDLLRQAGLEPVDRKGFVF
FT                   NPISWQWSISDRDLSVNYVTASLRPR"
     MQAHPNTVDP SEIAKFEAMA AEWWDPHGKF KPLHMLNPCR LDYITRQIAG EFDRDLGTER        60
     PFAGLRLLDI GCGGGLLSEP MARLGAEVVG ADAAEGNLPV ARIHAEQSGL EIDYRHTTAE       120
     ALAEAGEQFD VVLNMEVVEH VADPLSYLRA THDLLKPGGL QICSTINRNP KSYAMAILGA       180
     EVVMRWLPRG THDWSKFITP DELFDLLRQA GLEPVDRKGF VFNPISWQWS ISDRDLSVNY       240
     VTASLRPR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page