(data stored in ACNUC7421 zone)

EMBL: CP000031.UPGC

CP000031.UPGC        Location/Qualifiers
FT   CDS             complement(255969..257024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upgC"
FT                   /locus_tag="SPO0237"
FT                   /product="SN-glycerol-3-phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.20"
FT                   /note="identified by similarity to SP:P10907; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93562"
FT                   /db_xref="GOA:Q5LX21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX21"
FT                   /protein_id="AAV93562.1"
FT                   /translation="MASITLDNLVKAYGDTEVLHHVAGQIEDGEFIVIVGPSGCGKSTL
FT                   LRMVAGLETVTAGQISIGDRVVNQLEPADRDIAMVFQNYALYPHMSVRENMAYGLKIRK
FT                   ISKDEIARRVEEAADILELRPYLDRKPRQLSGGQRQRVAMGRAIVRNPQVFLFDEPLSN
FT                   LDAKLRVQMRLEIRKLQQRLGVTSIYVTHDQVEAMTLGDRLMVLNGGYVEQFGTPIELY
FT                   DRPATTFVAGFIGSPAMNFLPATAAEGSVTLANGARIAGSGTAHGTVTLGLRPEHLLPD
FT                   EGGPVRVRVELVEQLGANSLLHGQLEGTDTEMVVSMPGHMSAAADAVMAFTPTADSLHL
FT                   FDPETGKRIAE"
     MASITLDNLV KAYGDTEVLH HVAGQIEDGE FIVIVGPSGC GKSTLLRMVA GLETVTAGQI        60
     SIGDRVVNQL EPADRDIAMV FQNYALYPHM SVRENMAYGL KIRKISKDEI ARRVEEAADI       120
     LELRPYLDRK PRQLSGGQRQ RVAMGRAIVR NPQVFLFDEP LSNLDAKLRV QMRLEIRKLQ       180
     QRLGVTSIYV THDQVEAMTL GDRLMVLNGG YVEQFGTPIE LYDRPATTFV AGFIGSPAMN       240
     FLPATAAEGS VTLANGARIA GSGTAHGTVT LGLRPEHLLP DEGGPVRVRV ELVEQLGANS       300
     LLHGQLEGTD TEMVVSMPGH MSAAADAVMA FTPTADSLHL FDPETGKRIA E                351
//

If you have problems or comments...

PBIL Back to PBIL home page