(data stored in ACNUC7421 zone)

EMBL: CP000038.AROP

CP000038.AROP        Location/Qualifiers
FT   CDS             complement(129406..130779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="SSON_0120"
FT                   /old_locus_tag="SSO_0120"
FT                   /product="aromatic amino acid transport protein"
FT                   /note="Code: E; COG: COG1113"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86914"
FT                   /db_xref="GOA:Q3Z5P8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5P8"
FT                   /protein_id="AAZ86914.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   IVAMIIFGGWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
     MMEGQQHGEQ LKRGLKNRHI QLIALGGAIG TGLFLGSASV IQSAGPGIIL GYAIAGFIAF        60
     LIMRQLGEMV VEEPVAGSFS HFAYKYWGSF AGFASGWNYW VLYVLVAMAE LTAVGKYIQF       120
     WYPEIPTWVS AAVFFVVINA INLTNVKVFG EMEFWFAIIK VIAIVAMIIF GGWLLFSGNG       180
     GPQASVSNLW DQGGFLPHGF TGLVMMMAII MFSFGGLELV GITAAEADNP EQSIPKATNQ       240
     VIYRILIFYI GSLAVLLSLM PWTRVTADTS PFVLIFHELG DTFVANALNI VVLTAALSVY       300
     NSCVYCNSRM LFGLAQQGNA PKALASVDKR GVPVNTILVS ALVTALCVLI NYLAPESAFG       360
     LLMALVVSAL VINWAMISLA HMKFRRAKQE QGVVTRFPAL LYPLGNWICL LFMAAVLVIM       420
     LMTPGMAISV YLIPVWLIVL GIGYLFKEKT AKAVKAH                                457
//

If you have problems or comments...

PBIL Back to PBIL home page