(data stored in ACNUC7421 zone)

EMBL: CP000038.CITB

CP000038.CITB        Location/Qualifiers
FT   CDS             613642..614322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="SSON_0573"
FT                   /old_locus_tag="SSO_0573"
FT                   /product="sequence similarity to Shigella regulator"
FT                   /note="Code: KT; COG: COG4565"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87339"
FT                   /db_xref="GOA:Q3Z4H3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4H3"
FT                   /protein_id="AAZ87339.1"
FT                   /translation="MTAPLTLLIVEDETPLAEMHAEYIRHIPGFSQILLAGNLAQARMM
FT                   IERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDY
FT                   LIKPIAYERLGQTLTRFRQRKHMLESIDSASQKQIDEMFNAYARGEPKDELPTGIDPLT
FT                   LNAVRKLFKEPGVQHTAETVAQALTISCTTARRYLEYCASRHLIIAEIVHGKVGRPQRI
FT                   YHSG"
     MTAPLTLLIV EDETPLAEMH AEYIRHIPGF SQILLAGNLA QARMMIERFK PGLILLDNYL        60
     PDGRGINLLH ELVQAHYPGD VVFTTAASDM ETVSEAVRCG VFDYLIKPIA YERLGQTLTR       120
     FRQRKHMLES IDSASQKQID EMFNAYARGE PKDELPTGID PLTLNAVRKL FKEPGVQHTA       180
     ETVAQALTIS CTTARRYLEY CASRHLIIAE IVHGKVGRPQ RIYHSG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page