(data stored in ACNUC7421 zone)

EMBL: CP000038.CLPP

CP000038.CLPP        Location/Qualifiers
FT   CDS             445474..446097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SSON_0420"
FT                   /old_locus_tag="SSO_0420"
FT                   /product="ATP-dependent proteolytic subunit of clpA-clpP
FT                   serine protease"
FT                   /note="heat shock protein F21.5; Code: OU; COG: COG0740"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87196"
FT                   /db_xref="GOA:Q3Z4W6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4W6"
FT                   /protein_id="AAZ87196.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     MSYSGERDNF APHMALVPMV IEQTSRGERS FDIYSRLLKE RVIFLTGQVE DHMANLIVAQ        60
     MLFLEAENPE KDIYLYINSP GGVITAGMSI YDTMQFIKPD VSTICMGQAA SMGAFLLTAG       120
     AKGKRFCLPN SRVMIHQPLG GYQGQATDIE IHAREILKVK GRMNELMALH TGQSLEQIER       180
     DTERDRFLSA PEAVEYGLVD SILTHRN                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page