(data stored in ACNUC7421 zone)

EMBL: CP000038.DINJ

CP000038.DINJ        Location/Qualifiers
FT   CDS             complement(296389..296649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="SSON_0268"
FT                   /old_locus_tag="SSO_0268"
FT                   /product="damage-inducible protein J"
FT                   /note="Code: L; COG: COG3077"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87052"
FT                   /db_xref="GOA:Q3Z5B0"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B0"
FT                   /protein_id="AAZ87052.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGI"
     MAANAFVRAR IDEDLKNQAA DVLAGMGLTI SDLVRITLTK VAREKALPFD LREPNQLTIQ        60
     SIKNSEAGVD VHKAKDADDL FDKLGI                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page