(data stored in ACNUC7421 zone)

EMBL: CP000038.FEPA

CP000038.FEPA        Location/Qualifiers
FT   CDS             complement(569699..571939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="SSON_0534"
FT                   /old_locus_tag="SSO_0534"
FT                   /product="outer membrane receptor for ferric enterobactin
FT                   (enterochelin) and colicins B and D"
FT                   /note="Code: P; COG: COG4771"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87302"
FT                   /db_xref="GOA:Q3Z4L0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4L0"
FT                   /protein_id="AAZ87302.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNL
FT                   QAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENT
FT                   LILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGV
FT                   VNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDKTQA
FT                   DAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNL
FT                   YAGDTQNTNSDSYTRSKYGDETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRNSRIP
FT                   EGLAGGTEGKFNEKATQDFVDIDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRMKDL
FT                   SSNTQALTGANTGGAIDGVSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHS
FT                   IVGNNWSPALNISQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCY
FT                   QQGNDDLKAETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTDLYQ
FT                   WDNVPKAVVEGLEGSLNVPVSEMVMWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSW
FT                   QAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNVSLT
FT                   GGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSVNTHF"
     MNKKIHSLAL LVNLGIYGVA QAQEPTDTPV SHDDTIVVTA AEQNLQAPGV STITADEIRK        60
     NPVARDVSEI IRTMPGVNLT GNSTSGQRGN NRQIDIRGMG PENTLILIDG KPVSSRNSVR       120
     QGWRGERDTR GDTSWVPPEM IERIEVLRGP AAARYGNGAA GGVVNIITKK GSGEWHGSWD       180
     AYFNAPEHKE EGATKRTNFS LTGPLGDEFS FRLYGNLDKT QADAWDINQG HQSARAGTYA       240
     TTLPAGREGV INKDINGVVR WDFAPLQSLE LEAGYSRQGN LYAGDTQNTN SDSYTRSKYG       300
     DETNRLYRQN YSLTWNGGWD NGVTTSNWVQ YEHTRNSRIP EGLAGGTEGK FNEKATQDFV       360
     DIDLDDVMLH SEVNLPIDFL VNQTLTLGTE WNQQRMKDLS SNTQALTGAN TGGAIDGVSA       420
     TDRSPYSKAE IFSLFAENNM ELTDSTIVTP GLRFDHHSIV GNNWSPALNI SQGLGDDFTL       480
     KMGIARAYKA PSLYQTNPNY ILYSKGQGCY ASAGGCYQQG NDDLKAETSI NKEIGLEFKR       540
     DGWLAGVTWF RNDYRNKIEA GYVAVGQNAV GTDLYQWDNV PKAVVEGLEG SLNVPVSEMV       600
     MWTNNITYML KSENKTTGDR LSIIPEYTLN STLSWQARED LSMQTTFTWY GKQQPKKYNY       660
     KGQPAVGPET KEISPYSIVG LSATWDVTKN VSLTGGVDNL FDKRLWRAGN AQTTGDLAGA       720
     NYIAGAGAYT YNEPGRTWYM SVNTHF                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page