(data stored in ACNUC7421 zone)

EMBL: CP000038.FEPB

CP000038.FEPB        Location/Qualifiers
FT   CDS             complement(583076..584041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="SSON_0543"
FT                   /old_locus_tag="SSO_0543"
FT                   /product="ferric enterobactin binding protein periplasmic
FT                   component"
FT                   /note="enterochelin binding protein; Code: P; COG: COG4592"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87311"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4K1"
FT                   /protein_id="AAZ87311.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAVVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYTLGTETFRLDYYSAMQVLDRLNSLLKKD"
     MRLAPLYRNA LLLTGLLLSG IAVVQAADWP RQITDSRGTH TLESQPQRIV STSVTLTGSL        60
     LAIDAPVIAS GATTPNNRVA DDQGFLRQWS KVAKERKLQR LYIGEPSAEA VAAQMPDLIL       120
     ISATGGDSAL ALYDQLSTIA PTLIINYDDK SWQSLLTQLG EITGHEKQAA ERIAQFDKQL       180
     AAAKEQIKLP PQPVTAIVYT AAAHSANLWT PESAQGQMLE QLGFTLAKLP AGLNASQSQG       240
     KRHDIIQLGG ENLAAGLNGE SLFLFAGDQK DADAIYANPL LAHLPAVQNK QVYTLGTETF       300
     RLDYYSAMQV LDRLNSLLKK D                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page