(data stored in ACNUC7421 zone)

EMBL: CP000038.FHUA

CP000038.FHUA        Location/Qualifiers
FT   CDS             181681..183870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SSON_0162"
FT                   /old_locus_tag="SSO_0162"
FT                   /product="outer membrane protein receptor/transporter for
FT                   ferrichrome, colicin M, and phages T1, T5, and phi80"
FT                   /note="Code: P; COG: COG1629"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86955"
FT                   /db_xref="GOA:Q3Z5K7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5K7"
FT                   /protein_id="AAZ86955.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVT
FT                   AAPAPQESAWGPAATIAAKHSATATKTDTPIEKTPQSISVVTNEEMQMRQFQSVKEALG
FT                   YTPGVTVSSRGASNTYDFVIIRGFSSVGLNQNNYLDGLKLQGNFYNDAVIDPYMLERVE
FT                   LMRGPTSVLYGKSNPGGIISMVSKRPTTEPLKEIQFKMGTDNLFQTGFDFSDALDDNGE
FT                   FSYRLTGLARSTNEQQKNSESQRYTIAPSFSWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGASNNTYSRNQKMVGYSFEHGFNDTFTVRQNLRFSEMKT
FT                   SQKSVYGTGIAGDGHTLNRGTVVDNERLQNFSVDTQLESKFATGDVEHTLLTGVDFMRM
FT                   RNDINASFGSAPSIDLYNKYHPEYFAFGSAEPYQMNESKQTGIYVQDQAEWNKWVFTLG
FT                   GRYDWSKQATTVRENSYTPTEGYIERNDHQFTWRGGVNYLFDNGISPYFSYSQSFEPSA
FT                   FDLWSNPRISYKPSKGEQYEAGVKYVPNDMPVVVTGAVYQLTKTNNLTADPTNPLAQVP
FT                   AGEIRARGVELEAKAALNANINLTASYTYTDAEYTKDTNLKGKTPEQVPEHMASLWGDY
FT                   TFNEGPLSGLTLGTGGRFIGSSYGDPANTFKVGSTAVMDAVVKYDLARFGMAGSSLAVN
FT                   VNNLLDREYVASCFQTYGCFWGAERQVVATATFRF"
     MARSKTAQPK HSLRKIAVVV ATAVSGMSVY AQAAVEPKED TITVTAAPAP QESAWGPAAT        60
     IAAKHSATAT KTDTPIEKTP QSISVVTNEE MQMRQFQSVK EALGYTPGVT VSSRGASNTY       120
     DFVIIRGFSS VGLNQNNYLD GLKLQGNFYN DAVIDPYMLE RVELMRGPTS VLYGKSNPGG       180
     IISMVSKRPT TEPLKEIQFK MGTDNLFQTG FDFSDALDDN GEFSYRLTGL ARSTNEQQKN       240
     SESQRYTIAP SFSWRPDDKT NFTFLSYFQN EPETGYYGWL PKEGTVEPLP NGKRLPTDFN       300
     EGASNNTYSR NQKMVGYSFE HGFNDTFTVR QNLRFSEMKT SQKSVYGTGI AGDGHTLNRG       360
     TVVDNERLQN FSVDTQLESK FATGDVEHTL LTGVDFMRMR NDINASFGSA PSIDLYNKYH       420
     PEYFAFGSAE PYQMNESKQT GIYVQDQAEW NKWVFTLGGR YDWSKQATTV RENSYTPTEG       480
     YIERNDHQFT WRGGVNYLFD NGISPYFSYS QSFEPSAFDL WSNPRISYKP SKGEQYEAGV       540
     KYVPNDMPVV VTGAVYQLTK TNNLTADPTN PLAQVPAGEI RARGVELEAK AALNANINLT       600
     ASYTYTDAEY TKDTNLKGKT PEQVPEHMAS LWGDYTFNEG PLSGLTLGTG GRFIGSSYGD       660
     PANTFKVGST AVMDAVVKYD LARFGMAGSS LAVNVNNLLD REYVASCFQT YGCFWGAERQ       720
     VVATATFRF                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page