(data stored in ACNUC7421 zone)

EMBL: CP000038.FIXA

CP000038.FIXA        Location/Qualifiers
FT   CDS             51701..52507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="SSON_0049"
FT                   /old_locus_tag="SSO_0049"
FT                   /product="FixA"
FT                   /note="probable flavoprotein subunit, carnitine metabolism;
FT                   Code: C; COG: COG2086"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86845"
FT                   /db_xref="GOA:Q3Z5W7"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5W7"
FT                   /protein_id="AAZ86845.1"
FT                   /translation="MNDVSFMISGDAMKIITCYKCVPDEQDIAVNNADGSLDFSKADAK
FT                   ISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQF
FT                   EQALPQQTASALAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIIS
FT                   LTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAAD
FT                   IGFNAEAAWSEQQVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     MNDVSFMISG DAMKIITCYK CVPDEQDIAV NNADGSLDFS KADAKISQYD LNAIEAACQL        60
     KQQAAEAQVT ALSVGGKALT NAKGRKDVLS RGPDELIVVI DDQFEQALPQ QTASALAAAA       120
     QKAGFDLILC GDGSSDLYAQ QVGLLVGEIL NIPAVNGVSK IISLTADTLT VERELEDETE       180
     TLSIPLPAVV AVSTDINSPQ IPSMKAILGA AKKPVQVWSA ADIGFNAEAA WSEQQVAAPK       240
     QRERQRIVIE GDGEEQIAAF AENLRKVI                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page