(data stored in ACNUC7421 zone)

EMBL: CP000038.FSR

CP000038.FSR         Location/Qualifiers
FT   CDS             complement(496905..498047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="SSON_0468"
FT                   /old_locus_tag="SSO_0468"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87244"
FT                   /db_xref="GOA:Q3Z4R8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4R8"
FT                   /protein_id="AAZ87244.1"
FT                   /translation="MAMSEQPQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTEVA"
     MAMSEQPQPV AGAAASTTKA RTSFGILGAI SLSHLLNDMI QSLILAIYPL LQSEFSLTFM        60
     QIGMITLTFQ LASSLLQPVV GYWTDKYPMP WSLPIGMCFT LSGLVLLALA GSFGAVLLAA       120
     ALVGTGSSVF HPESSRVARM ASGGRHGLAQ SIFQVGGNFG SSLGPLLAAV IIAPYGKGNV       180
     AWFVLAALLA IVVLAQISRW YSAQHRMNKG KPKATIINPL PRNKVVLAVS ILLILIFSKY       240
     FYMASISSYY TFYLMQKFGL SIQNAQLHLF AFLFAVAAGT VIGGPVGDKI GRKYVIWGSI       300
     LGVAPFTLIL PYASLHWTGV LTVIIGFILA SAFSAILVYA QELLPGRIGM VSGLFFGFAF       360
     GMGGLGAAVL GLIADHTEVA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page