(data stored in ACNUC7421 zone)

EMBL: CP000038.FTSL

CP000038.FTSL        Location/Qualifiers
FT   CDS             100369..100734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SSON_0091"
FT                   /old_locus_tag="SSO_0091"
FT                   /product="cell division protein"
FT                   /note="ingrowth of wall at septum; Code: D; COG: COG3116"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86886"
FT                   /db_xref="GOA:Q3Z5S6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5S6"
FT                   /protein_id="AAZ86886.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page