(data stored in ACNUC7421 zone)

EMBL: CP000038.HHA

CP000038.HHA         Location/Qualifiers
FT   CDS             complement(472284..472502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="SSON_0447"
FT                   /old_locus_tag="SSO_0447"
FT                   /product="haemolysin expression modulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87223"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4T9"
FT                   /protein_id="AAZ87223.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
     MSEKPLTKTD YLMRLRRCQT IDTLERVIEK NKYELSDNEL AVFYSAADHR LAELTMNKLY        60
     DKIPSSVWKF IR                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page