(data stored in ACNUC7421 zone)

EMBL: CP000038.HOFC

CP000038.HOFC        Location/Qualifiers
FT   CDS             complement(123749..124951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="SSON_0114"
FT                   /old_locus_tag="SSO_0114"
FT                   /product="putative integral membrane protein"
FT                   /note="involved in biogenesis of fimbriae, protein
FT                   transport, DNA uptake; Code: NU; COG: COG1459"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86909"
FT                   /db_xref="GOA:Q3Z5Q3"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Q3"
FT                   /protein_id="AAZ86909.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVL
FT                   FGFLLAIANKLLMRRPTWLIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNTGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPTLLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     MASKQLWRWH GITGDGNAQD GMLWAESRAL LLMALQQQMV TPLSLKRIAI NSAQWRGDKS        60
     AEVIHQLATL LKAGLTLSEG LALLAEQHPS KQWQALLQSL AHDLEQGIAF SNALLPWSEV       120
     FPPLYQAMIR TGELTGKLDE CCFELARQQK AQRQLTDKVK SALRYPIIIL AMAIMVVVAM       180
     LHFVLPEFAA IYKTFNTPLP ALTQGIMTLA DFSGEWSWLL VLFGFLLAIA NKLLMRRPTW       240
     LIVRQKLLLR IPIMGSLMRG QKLTQIFTIL ALTQSAGITF LQGVESVRET MRCPYWVQLL       300
     TQIQHDISNG HPIWLALKNT GEFSPLCLQL VRTGEASGSL DLMLDNLAHH HRDNTMALAD       360
     NLAALLEPTL LIITGGIIGT LVVAMYLPIF HLGDAMSGMG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page