(data stored in ACNUC7421 zone)

EMBL: CP000038.LEUD

CP000038.LEUD        Location/Qualifiers
FT   CDS             complement(87408..88013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SSON_0078"
FT                   /old_locus_tag="SSO_0078"
FT                   /product="isopropylmalate isomerase subunit"
FT                   /note="Code: E; COG: COG0066"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86873"
FT                   /db_xref="GOA:Q3Z5T9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5T9"
FT                   /protein_id="AAZ86873.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMN"
     MAEKFIKHTG LVVPLDAANV DTDAIIPKQF LQKVTRTGFG AHLFNDWRFL DEKGQQPNPD        60
     FVLNFPQYQG ASILLARENF GCGSSREHAP WALTDYGFKV VIAPSFADIF YGNSFNNQLL       120
     PVKLSDAEVD ELFALVKANP GIHFDVDLEA QEVKAGEKTY RFTIDAFRRH CMMNGLDSIG       180
     LTLQHDDAIA AYEAKQPAFM N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page