(data stored in ACNUC7421 zone)

EMBL: CP000038.MBHA

CP000038.MBHA        Location/Qualifiers
FT   CDS             301152..301937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="SSON_0272"
FT                   /old_locus_tag="SSO_0272"
FT                   /product="putative motility protein"
FT                   /note="Code: N; COG: COG1360"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87056"
FT                   /db_xref="GOA:Q3Z5A5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5A5"
FT                   /protein_id="AAZ87056.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSITTIARDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKN
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDSKNPQSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
     MTTIKLIVNS VSKSERESII AALHGQSIFN GGGLSPLNKI SPSHPPKPAT VAVPEETEKK        60
     ARDVNEKTAL LKKKSATELG ELATSITTIA RDAHMEANLE MEIVPQGLRV LIKDDQNRNM       120
     FERGSAQIMP FFKTLLVELA PVFDSLDNKI IITGHTDAMA YKNNIYNNWN LSGDRALSAR       180
     RVLEEAGMPE DKVMQVSAMA DQMLLDSKNP QSAGNRRIEI MVLTKSASDT LYQYFGQHGD       240
     KVVQPLVQKL DKQQVLSQRT R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page