(data stored in ACNUC7421 zone)

EMBL: CP000038.MESJ

CP000038.MESJ        Location/Qualifiers
FT   CDS             228691..229989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="SSON_0201"
FT                   /old_locus_tag="SSO_0201"
FT                   /product="cell cycle protein"
FT                   /note="Code: D; COG: COG0037"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86993"
FT                   /db_xref="GOA:Q3Z5G9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5G9"
FT                   /protein_id="AAZ86993.1"
FT                   /translation="MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGVTLR
FT                   AIHVHHGLSANADAWVRHCENICQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMGEVSEFAGTRLIRPLLARTRGEL
FT                   EQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESL
FT                   LDELLADDLAHCQTSQGTLQIAPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRFGAFEIRRYQSQLWWIKSVTGQSETIVPWQTWLQPLELPAGLGSVQ
FT                   LTAGGDIRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGVFVTQEGVAEGENGVSFVWQKTLS"
     MTLTLNRQLL TSRQILVAFS GGLDSTVLLH QLVQWRTENP GVTLRAIHVH HGLSANADAW        60
     VRHCENICQQ WQVPLVVERV QLAQEGLGIE AQARQARYQA FARTLLPGEV LVTAQHLDDQ       120
     CETFLLALKR GSGPAGLSAM GEVSEFAGTR LIRPLLARTR GELEQWALAH GLRWIEDESN       180
     QDDSYDRNFL RLRVVPLLQQ RWPHFAEATA RSAALCAEQE SLLDELLADD LAHCQTSQGT       240
     LQIAPMLAMS DARRAAIIRR WLAGQNAPMP SRDALVRIWQ EVALAREDAS PCLRFGAFEI       300
     RRYQSQLWWI KSVTGQSETI VPWQTWLQPL ELPAGLGSVQ LTAGGDIRPP RADEAVSVRF       360
     KAPGLLHIVG RNGGRKLKKI WQELGVPPWL RDTTPLLFYG ETLIAAAGVF VTQEGVAEGE       420
     NGVSFVWQKT LS                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page