(data stored in ACNUC7421 zone)

EMBL: CP000038.PE105

CP000038.PE105       Location/Qualifiers
FT   CDS             complement(120791..120925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0108"
FT                   /old_locus_tag="SSO_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Q9"
FT                   /protein_id="AAZ86903.1"
FT                   /translation="MAIFPKAMTGAKSQSSDICLMPHVGLIRRGQRRIRHLVQMSDAA"
     MAIFPKAMTG AKSQSSDICL MPHVGLIRRG QRRIRHLVQM SDAA                         44
//

If you have problems or comments...

PBIL Back to PBIL home page