(data stored in ACNUC7421 zone)

EMBL: CP000038.PE219

CP000038.PE219       Location/Qualifiers
FT   CDS             complement(256165..256647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0233"
FT                   /old_locus_tag="SSO_0233"
FT                   /product="Hcp-like protein"
FT                   /note="Code: S; COG: COG3157"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87017"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5E5"
FT                   /protein_id="AAZ87017.1"
FT                   /translation="MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALM
FT                   HSISRSQNVNHHELIITKPVDKSSPLLAKALSDNEKMAICEFILYRTSKAGIYQPYYKI
FT                   NLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDISWEHTLAGTNAMSKWQDRVQ"
     MANISYLSLS GETQGLISAG CSTLDSVGNK AQPEHKDQIM VYALMHSISR SQNVNHHELI        60
     ITKPVDKSSP LLAKALSDNE KMAICEFILY RTSKAGIYQP YYKINLSKAR ISSIDFVTPH       120
     AVLEKELEPQ ERIAFIYEDI SWEHTLAGTN AMSKWQDRVQ                             160
//

If you have problems or comments...

PBIL Back to PBIL home page