(data stored in ACNUC7421 zone)

EMBL: CP000038.PE22

CP000038.PE22        Location/Qualifiers
FT   CDS             complement(22741..23424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0023"
FT                   /old_locus_tag="SSO_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86820"
FT                   /db_xref="GOA:Q3Z5Z2"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Z2"
FT                   /protein_id="AAZ86820.1"
FT                   /translation="MNLTVKKIELPGRSSYNLEEMLSAINFTIPYSIASVSDSSNTADI
FT                   FPGTPFPLLFEIEVSSCTGNNTNCNSVRFNYNLNTILQVNLMTCGFEDQSIDTGRFVLS
FT                   RINNENYQFHHIRFDCIQGEQGELVFEPSDVEYYFEPVTIQESGTSILKNELENSEDGA
FT                   GQVGFQPSNDGTNEIQYGKSNYYSFQHPHEGSNQIPLFIRPRTYGNNVSSGQIMSRVKI
FT                   VVMYN"
     MNLTVKKIEL PGRSSYNLEE MLSAINFTIP YSIASVSDSS NTADIFPGTP FPLLFEIEVS        60
     SCTGNNTNCN SVRFNYNLNT ILQVNLMTCG FEDQSIDTGR FVLSRINNEN YQFHHIRFDC       120
     IQGEQGELVF EPSDVEYYFE PVTIQESGTS ILKNELENSE DGAGQVGFQP SNDGTNEIQY       180
     GKSNYYSFQH PHEGSNQIPL FIRPRTYGNN VSSGQIMSRV KIVVMYN                     227
//

If you have problems or comments...

PBIL Back to PBIL home page