(data stored in ACNUC7421 zone)

EMBL: CP000038.PE221

CP000038.PE221       Location/Qualifiers
FT   CDS             complement(258034..258720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0235"
FT                   /old_locus_tag="SSO_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87019"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5E3"
FT                   /protein_id="AAZ87019.1"
FT                   /translation="MEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGI
FT                   LDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
FT                   ETVSLSGNKRRSVLNLDSQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRS
FT                   ISFSGPWAQFRLFWAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFG
FT                   LSDTLY"
     MEVDWRDSVV KPFNEQLANN YPFNPRSAQD ASLDAFERFF KPDGILDTFY QQNLKLFIDN        60
     DLSLEDGDNN VIIREDIIAQ LETAQKIRDI FFSKQNGLGT SFAVETVSLS GNKRRSVLNL       120
     DSQLVDYSQG RNYTAHLVWP NNMREGNESK LTLIGTSGNA PRSISFSGPW AQFRLFWAGQ       180
     LTGVQDGNFT VRFSVDGGAM TYRVHTDTED NPFSGGLFSQ FGLSDTLY                    228
//

If you have problems or comments...

PBIL Back to PBIL home page