(data stored in ACNUC7421 zone)

EMBL: CP000038.PE225

CP000038.PE225       Location/Qualifiers
FT   CDS             complement(261215..262894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0239"
FT                   /old_locus_tag="SSO_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87023"
FT                   /db_xref="GOA:Q3Z5D9"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5D9"
FT                   /protein_id="AAZ87023.1"
FT                   /translation="MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWW
FT                   KGPMWTLYEEQWLKPLANRWLATAAWGIIALVWLTVRVMKRLQQLEKMQKQQREEAVDP
FT                   LSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIY
FT                   APEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQ
FT                   PLNGIILTLDLPDLLTADKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGF
FT                   AALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHT
FT                   RASLFSFSRQMQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAAR
FT                   QYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGG
FT                   VAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGEDDFGNLQLPLLNPVRDATL
FT                   AYGDWGDRSRLADMGLYQGRRIGPYVVDWPPESPDNQYHLNK"
     MFRLPTPRLL SGLKSALRPA MPRFKVSAFW LLILAWIFLL VWIWWKGPMW TLYEEQWLKP        60
     LANRWLATAA WGIIALVWLT VRVMKRLQQL EKMQKQQREE AVDPLSVELN AQQRYLDRWL       120
     LRLQRHLDNR RFLWQLPWYM VIGPAGSGKT TLLREGFPSD IIYAPEGARG AEQRLYLTPH       180
     VGKQAVIFDI DGTLCAPADA DILHRRLWEH ALGWLKEKRA RQPLNGIILT LDLPDLLTAD       240
     KRRREHLLQT LRSRLQDIRQ HLHCQLPVYV VLTRLDLLQG FAALFQSLNR QDRDAILGVT       300
     FTRRAHENDD WRTELNAFWQ TWVDRMNLAL PDLMVAQTHT RASLFSFSRQ MQGSREPLVS       360
     LLEGLLDGEN MNVMLRGVYL TSSLQRGQMD DIFTQSAARQ YRLGNNPLAS WPLVDTAPYF       420
     TRSLFPQALL AEPNLATESR AWLIRSRRRL TVFSATGGVA ALLLITGWHH YYNGNYQSGI       480
     TVLKQAKAFM DVPPPQGEDD FGNLQLPLLN PVRDATLAYG DWGDRSRLAD MGLYQGRRIG       540
     PYVVDWPPES PDNQYHLNK                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page