(data stored in ACNUC7421 zone)

EMBL: CP000038.PE226

CP000038.PE226       Location/Qualifiers
FT   CDS             complement(262913..264325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0240"
FT                   /old_locus_tag="SSO_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3515"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87024"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5D8"
FT                   /protein_id="AAZ87024.1"
FT                   /translation="MAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKL
FT                   GSLAHSQLDIPELQRRGLVILASESKDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYW
FT                   AVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATAQRDALSGELAKLAQCWQSHNAPE
FT                   LAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQPSAPAPQIVIDSH
FT                   DDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDSRTPLAAVSADM
FT                   VADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIHDEVIRF
FT                   LERLPQLTGLLFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEA
FT                   ALRYLDMLPEGDPRDQFHRQYLAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSL
FT                   LEQLEQKFTAEQ"
     MAMDLRDPNV WISHLLENLP EEKLASALKD DNPNWEYIDG EIVKLGSLAH SQLDIPELQR        60
     RGLVILASES KDFRLLAHLL RTLQHAGDPH LALRLLALYV EHYWAVAAPQ NMAHKKRFAS       120
     QVIKRFETGI EVFSQNAATA QRDALSGELA KLAQCWQSHN APELAQATDD LFALYQRAFN       180
     RAAPAPVPTP AASGSSPQTT ATSESGVTQP SAPAPQIVID SHDDKAWRDT LLKVAAILCE       240
     RQPDSPQGYR LRRHALWQNI TSTPQAESDS RTPLAAVSAD MVADYHAQLG SADMALWQQV       300
     EKSVLLAPYW LDGHCLSAQT ALRLGYKQVA DAIHDEVIRF LERLPQLTGL LFNDHTPFIS       360
     EQTKQWLAAS PDAKVAPVAQ IGEESKAARA CFAEQGLEAA LRYLDMLPEG DPRDQFHRQY       420
     LAAQLTEEAG LVQLAQQQYR MLFRMGLQMM VADWEPSLLE QLEQKFTAEQ                  470
//

If you have problems or comments...

PBIL Back to PBIL home page