(data stored in ACNUC7421 zone)

EMBL: CP000038.PE227

CP000038.PE227       Location/Qualifiers
FT   CDS             complement(264330..265022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0241"
FT                   /old_locus_tag="SSO_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87025"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5D7"
FT                   /protein_id="AAZ87025.1"
FT                   /translation="MTGLPATAAPAEASSMAGVAVAVATTTPPDATATLQAMQSCRRES
FT                   AALERLDCYDRLLAPLSPSGFDGALVKAGFVGEAWTRATEQEKRREGNTTELLVTQVPG
FT                   ERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDVHDIAVTLNADNRALRSH
FT                   WFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAGKLTFNIDGLARAIAPLR
FT                   DACHWAGE"
     MTGLPATAAP AEASSMAGVA VAVATTTPPD ATATLQAMQS CRRESAALER LDCYDRLLAP        60
     LSPSGFDGAL VKAGFVGEAW TRATEQEKRR EGNTTELLVT QVPGERPTVV ITTPAIGHVP       120
     PRPVLMFSCV DNITRMQVAL MHPLDVHDIA VTLNADNRAL RSHWFVRENG TLLESSRGLS       180
     GIDEIKQLFG AKTLTVDTGA DNAAGKLTFN IDGLARAIAP LRDACHWAGE                  230
//

If you have problems or comments...

PBIL Back to PBIL home page