(data stored in ACNUC7421 zone)

EMBL: CP000038.PE230

CP000038.PE230       Location/Qualifiers
FT   CDS             complement(267856..268617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0244"
FT                   /old_locus_tag="SSO_0244"
FT                   /product="putative membrane protein"
FT                   /note="Code: S; COG: COG3455"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87028"
FT                   /db_xref="GOA:Q3Z5D4"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5D4"
FT                   /protein_id="AAZ87028.1"
FT                   /translation="MDEGSLSLPPFTGHDEKSQRNYHLALRGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWICFSLGFRGRY
FT                   KVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
     MDEGSLSLPP FTGHDEKSQR NYHLALRGNS LNPMIDAATP LLGMVMRLST MNSQTMPEHL        60
     FAQVVTDVQA VEQLLQEQGY EPGVIISFRY ILCTFIDEAA LGNGWSNKNE WIKQSLLVHF       120
     HNEAWGGEKV FILLERLIRE PKRYQDLLEF LWICFSLGFR GRYKVAAQDQ GEFEQIYRRL       180
     YHVLHKLRGD APFPLLHQDK KTQGGRYQLI SRLTVKHIFC GGVVVLALFY LFYLLRLDSQ       240
     TQDILHQLNK LLR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page