(data stored in ACNUC7421 zone)

EMBL: CP000038.PE235

CP000038.PE235       Location/Qualifiers
FT   CDS             complement(271780..272862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0249"
FT                   /old_locus_tag="SSO_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3520"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87033"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C9"
FT                   /protein_id="AAZ87033.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLAHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
     MDGKNRAASS YLSPGNPPAD KEQNDPLAQV FHNACSYNFF AMAELLHRLA KGEKGTPELS        60
     LRDDPAQETL RFSADASLAF PCSDISALKR DTSGAFRMTT TFMGLQGSQS PLPGYYLAHL       120
     AWKAVHEQSP VGDFLDMFSH RLTQFVWHIW RKYRYHISFR NGGVDAFSQR MYSLVGLGHR       180
     QLRDKLAINH SKMLAYSGIL ANPGRSPEII CGLVSHCFDL SEVTLQNWQR RKVDIEPDQQ       240
     NSLGSYSLKN GEKLAGRSVL GNFVLGTRVP DLSGKFQLSI TSLTRKQFLS FLPSGENFLP       300
     LTMFVSFILR DQLAWDLHLG LAPEQVGAMR LGDNKSALLG WTSFLGTPEE RPSVTIRVRS       360
//

If you have problems or comments...

PBIL Back to PBIL home page