(data stored in ACNUC7421 zone)

EMBL: CP000038.PE237

CP000038.PE237       Location/Qualifiers
FT   CDS             complement(275100..275648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0251"
FT                   /old_locus_tag="SSO_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87035"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C7"
FT                   /protein_id="AAZ87035.1"
FT                   /translation="MKDLPMHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRK
FT                   DSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWK
FT                   ERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPH
FT                   FKFMGANFELSLVGRLDRE"
     MKDLPMHLFE TMGQIQAKIP TEVLVTDRRE FELAEEGFIT LTMRKDSDNA AFFSANSVQK        60
     PKHFPGKDAE TNYKLGTQLP YLFIINRLAH YIKVLQREQL GSWKERSDLE RELNTWIRQY       120
     VADQENPPAD VRSRKPLRAA KVEVMDVEGE PGWYQVALSV RPHFKFMGAN FELSLVGRLD       180
     RE                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page