(data stored in ACNUC7421 zone)

EMBL: CP000038.PE240

CP000038.PE240       Location/Qualifiers
FT   CDS             complement(276885..277385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0254"
FT                   /old_locus_tag="SSO_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3516"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87038"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C4"
FT                   /protein_id="AAZ87038.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSPLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGLV
FT                   SNK"
     MSKKFEGSVA PRERINISYV PKTDGQTAEV ELPLNMLVVG DTGNTQETSP LDERQAVSVN        60
     KHNFGAVMAE AAIGLNFTVP ATLKGSTTDD ELNVALNIKS LDDFSPDSVA RQVPEVNKLL       120
     ELREALTALK GPMGNLPAFR TQLQALLENE ESREQLLKEI GLVSNK                      166
//

If you have problems or comments...

PBIL Back to PBIL home page