(data stored in ACNUC7421 zone)

EMBL: CP000038.PE243

CP000038.PE243       Location/Qualifiers
FT   CDS             281027..285235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0257"
FT                   /old_locus_tag="SSO_0257"
FT                   /product="rhs core protein with extension"
FT                   /note="Code: M; COG: COG3209"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87041"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C1"
FT                   /protein_id="AAZ87041.1"
FT                   /translation="MGGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGIT
FT                   YANPVNPVLGAKVLPGETDLALPCPLPFILFRAYSSYRTRTPAPVGVFGPGWKAPFDIR
FT                   LQIRDEGLILNDSGGRSIHFEPLFPGEISYSRSESLWLARGGVAAQHSSQPLSALWQVL
FT                   PEDVRLSPHVYLATNSLQGPWWILSWPEPPAYRVLTVVVDGFGRSLTFHRAAEGDVAGA
FT                   VTGVTDGAGRRFHMALSTQAQRAEASRKQRASSLSSPASPRSVSSSQVFPDTLPAGTEY
FT                   GADNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFTYDAEH
FT                   AGRMVAHHYAGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGESRVIITDSLNRREVLYT
FT                   EGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYRLHMASGKLTSVVLPD
FT                   GRTVRYGYNNQLQLTSVTYPDGLRSSRKYDRQGRLAEETSRNGNITRWFYDSSRSGLPC
FT                   AVEDGTGVRRRITRNRYGQLQAFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSYNPR
FT                   GQLVSQRDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVSTTQGGLTRSMGY
FT                   DAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYQYDLTGKLTQSEDEGLITL
FT                   WHYDASDRITRRTVNGEPAEQWQYDDHGWLTEISHLSEGHRVAVHYGYDDKGRLTGERQ
FT                   TVETPETGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVE
FT                   YTRDRLHRETARSFGGEAYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGP
FT                   QESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPELHPDSTLTAWPDNRIA
FT                   EDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFYTRIQHGEPQVE
FT                   SRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGDRLTTIQTGTTRIQTVY
FT                   QPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELSVMLGRLERELRAGAVS
FT                   AESEAWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPLALISPEGETAWQGEYD
FT                   EWGNLLGETSAQHLQQSLRLPGQQYDEESGLYYNRNRYYDPLQGRYITQDPIGLRGEWN
FT                   LYKYPLNPVRFIDSLGLKFHVNGDPSDFNQAVEYLKQDSQMKETIDFLSSSEETINIEY
FT                   IEGTNVRFNSNNMTIYWNSRASLFCSTELNSKSQSPALGLGHEFTHAQYCLLDKENFMA
FT                   LLSRTDKKYENKEEARVITIIESRAAKTLGECTRGAHSGLPFYRVDGPLQTMKITGTPE
FT                   "
     MGGGKPAARQ GDMTRKGLDI VQGSAGVLIG APTGVACSVC PGGITYANPV NPVLGAKVLP        60
     GETDLALPCP LPFILFRAYS SYRTRTPAPV GVFGPGWKAP FDIRLQIRDE GLILNDSGGR       120
     SIHFEPLFPG EISYSRSESL WLARGGVAAQ HSSQPLSALW QVLPEDVRLS PHVYLATNSL       180
     QGPWWILSWP EPPAYRVLTV VVDGFGRSLT FHRAAEGDVA GAVTGVTDGA GRRFHMALST       240
     QAQRAEASRK QRASSLSSPA SPRSVSSSQV FPDTLPAGTE YGADNGIRLE AVWLTHDPAY       300
     PDEQPTAPLA RYTYTAGGEL RAVYDRSGTQ VRGFTYDAEH AGRMVAHHYA GRPESRYRYD       360
     DTGRVTEQVN PEGLDYRFEY GESRVIITDS LNRREVLYTE GEGGLKRVVK KEHADGSITR       420
     SEYDEAGRLK AQTDAAGRRT EYRLHMASGK LTSVVLPDGR TVRYGYNNQL QLTSVTYPDG       480
     LRSSRKYDRQ GRLAEETSRN GNITRWFYDS SRSGLPCAVE DGTGVRRRIT RNRYGQLQAF       540
     TDCSGYTTRY EYDRYGQQIA VHREEGISTY SSYNPRGQLV SQRDAQGRET RYEYSAAGDL       600
     TAIVAPDGSR SEIQYDAWGK AVSTTQGGLT RSMGYDAAGR ITVLTNENGS QSTFRYDPVD       660
     RLTEQRGFDG RTQRYQYDLT GKLTQSEDEG LITLWHYDAS DRITRRTVNG EPAEQWQYDD       720
     HGWLTEISHL SEGHRVAVHY GYDDKGRLTG ERQTVETPET GEMLWEHETG HAYSEQGLAT       780
     RQEPDGLPPV EWLTYGSGYL AGMKLGGTPL VEYTRDRLHR ETARSFGGEA YELATAWNTS       840
     GQLRSRHLNL PQLDRDYDWN DNGQLIRISG PQESREYRYS DTGRLTGVHT TAANLDIDIP       900
     YATDPAGNRL PDPELHPDST LTAWPDNRIA EDAHYVYRYD EYGRLAEKTD RIPEGVIRMH       960
     DERTHHYHYD SQHRLVFYTR IQHGEPQVES RYLYDPLGRR TGKRVWRRER DLTGWMSLSR      1020
     KPEVTWYGWD GDRLTTIQTG TTRIQTVYQP GSFTPLLRIE TENGEQAKAR HRSLAEVLQE      1080
     DTGVTLPAEL SVMLGRLERE LRAGAVSAES EAWLAQCGLT AEQMAAQLEA EYIPERKLHL      1140
     YHCDHRGLPL ALISPEGETA WQGEYDEWGN LLGETSAQHL QQSLRLPGQQ YDEESGLYYN      1200
     RNRYYDPLQG RYITQDPIGL RGEWNLYKYP LNPVRFIDSL GLKFHVNGDP SDFNQAVEYL      1260
     KQDSQMKETI DFLSSSEETI NIEYIEGTNV RFNSNNMTIY WNSRASLFCS TELNSKSQSP      1320
     ALGLGHEFTH AQYCLLDKEN FMALLSRTDK KYENKEEARV ITIIESRAAK TLGECTRGAH      1380
     SGLPFYRVDG PLQTMKITGT PE                                               1402
//

If you have problems or comments...

PBIL Back to PBIL home page