(data stored in ACNUC7421 zone)

EMBL: CP000038.PE25

CP000038.PE25        Location/Qualifiers
FT   CDS             complement(25267..25635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0026"
FT                   /old_locus_tag="SSO_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86823"
FT                   /db_xref="GOA:Q3Z5Y9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Y9"
FT                   /protein_id="AAZ86823.1"
FT                   /translation="MAAWRYASQDYRTFSDHLYENDKHYHQSDYDDFYDIGRKNSLSAN
FT                   IMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSNNWQHISYTFSASQSYDENNKEE
FT                   ERFNLFISIPFYWGDDIG"
     MAAWRYASQD YRTFSDHLYE NDKHYHQSDY DDFYDIGRKN SLSANIMQPL SNNLGNVSLS        60
     ALWRNYWGRS GNAKDYQFSY SNNWQHISYT FSASQSYDEN NKEEERFNLF ISIPFYWGDD       120
     IG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page