(data stored in ACNUC7421 zone)

EMBL: CP000038.PE26

CP000038.PE26        Location/Qualifiers
FT   CDS             complement(26076..27197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0027"
FT                   /old_locus_tag="SSO_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Y8"
FT                   /protein_id="AAZ86824.1"
FT                   /translation="MDVFDDRTSECLSEEIKIYQECHEKFVNFLKANFNQEIYPQLYTP
FT                   EIFYEACRNLQSFYDHQETSQNAKYSAIDKKKSHLNQEIKKLIKKNIFPELYNEQCNKI
FT                   PSSSIDDNQGIMWQNFKTSNSAYSKLCGKLSLFKSVPSRLIEKSAYCSTENMATNKFNV
FT                   VFSYCGDNIKEFILLLPYNKSLEMYELNDQKIQYLTALNINIHKMLLSNITIEKSNLSY
FT                   GYYFCCVLTNISCFESDLSNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPG
FT                   RWTTQLVNKHLGYRYTGVFKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELNK
FT                   FMHDYDKTSSKMRKYLQSINECMLLIKNIVHQD"
     MDVFDDRTSE CLSEEIKIYQ ECHEKFVNFL KANFNQEIYP QLYTPEIFYE ACRNLQSFYD        60
     HQETSQNAKY SAIDKKKSHL NQEIKKLIKK NIFPELYNEQ CNKIPSSSID DNQGIMWQNF       120
     KTSNSAYSKL CGKLSLFKSV PSRLIEKSAY CSTENMATNK FNVVFSYCGD NIKEFILLLP       180
     YNKSLEMYEL NDQKIQYLTA LNINIHKMLL SNITIEKSNL SYGYYFCCVL TNISCFESDL       240
     SNTIFSNGEI NNLFIKKSNI FGTSFTNTMI KNLRCEDIMP GRWTTQLVNK HLGYRYTGVF       300
     KTLASIDDKP SRFEILIPLV QTLVRDNVKL NNDVYKELNK FMHDYDKTSS KMRKYLQSIN       360
     ECMLLIKNIV HQD                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page