(data stored in ACNUC7421 zone)

EMBL: CP000038.PE326

CP000038.PE326       Location/Qualifiers
FT   CDS             complement(373978..374250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0348"
FT                   /old_locus_tag="SSO_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87124"
FT                   /protein_id="AAZ87124.1"
FT                   /translation="MLRYRRMVQLFFPLSPNVDIYNLWRKTRIKLIKGRYFNMLQIMLF
FT                   LIHTRYKYQKHKPDKYLINIQQSLNYSIYSSTTKRQKKIITKSYK"
     MLRYRRMVQL FFPLSPNVDI YNLWRKTRIK LIKGRYFNML QIMLFLIHTR YKYQKHKPDK        60
     YLINIQQSLN YSIYSSTTKR QKKIITKSYK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page