(data stored in ACNUC7421 zone)

EMBL: CP000038.PE347

CP000038.PE347       Location/Qualifiers
FT   CDS             393496..393777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0369"
FT                   /old_locus_tag="SSO_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87145"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z517"
FT                   /protein_id="AAZ87145.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPASLLTTLTESQDRSLAINNPQLAAD
FT                   VKTAWLKEDLSLLLFVEQPDLSQLRDLVKTGATRKIRSEARHRLEEKQ"
     MLQSRNDHLR QTALRNAHTP ASLLTTLTES QDRSLAINNP QLAADVKTAW LKEDLSLLLF        60
     VEQPDLSQLR DLVKTGATRK IRSEARHRLE EKQ                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page