(data stored in ACNUC7421 zone)

EMBL: CP000038.PE489

CP000038.PE489       Location/Qualifiers
FT   CDS             complement(549478..550563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0518"
FT                   /old_locus_tag="SSO_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87287"
FT                   /db_xref="GOA:Q3Z4M5"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4M5"
FT                   /protein_id="AAZ87287.1"
FT                   /translation="MRMLSQQAMVASQMKRAANDKAIAQMLASKKSGPPAARLGDEIQH
FT                   KSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQL
FT                   ESWINSFCDTDGAINTGSENVKINGELAARAAVTLPPPPPPGAIPEVPQGEPSWGDIAT
FT                   DLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASLLFPAGPVLMEFATMVGGR
FT                   GEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGS
FT                   PDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNCW
FT                   GKAGSCWAQSSARCWGKQVSR"
     MRMLSQQAMV ASQMKRAAND KAIAQMLASK KSGPPAARLG DEIQHKSFLG ALAGAVLGAI        60
     VTIAEGCLIM AACATGPYAL VLVPALMYAS YKASDYVEEK QNQLESWINS FCDTDGAINT       120
     GSENVKINGE LAARAAVTLP PPPPPGAIPE VPQGEPSWGD IATDLLESAA EKAVPLAKAW       180
     GNAVITLTDS NAGFMDRVSA GASLLFPAGP VLMEFATMVG GRGEIKKDVD FPEAGEDTAL       240
     CDKENKPPRI AQGSSNVFIN NQPAARKGDK LECSAAIVGG SPDVFIGGEQ VTYLDIQPEF       300
     PPWQRMILGG ITIASYLLPP AGLLGKLKNL ARLGKLGNCW GKAGSCWAQS SARCWGKQVS       360
     R                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page