(data stored in ACNUC7421 zone)

EMBL: CP000038.PE530

CP000038.PE530       Location/Qualifiers
FT   CDS             602410..602871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0561"
FT                   /old_locus_tag="SSO_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87328"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4I4"
FT                   /protein_id="AAZ87328.1"
FT                   /translation="MLLPWLFPQTKRNNFAAKVNSENQEKLLILRKEDASASSGQSELS
FT                   LVQMGLKQVVASSFWLVFEFQHFKVGCNAARKFPVNGIANAQPQQCGTYRSHNGKLSIA
FT                   IGHFCRIHQRAHTHFAIAKIAEFNPAVHCHHVVWHLFWRTHLGAIQLCV"
     MLLPWLFPQT KRNNFAAKVN SENQEKLLIL RKEDASASSG QSELSLVQMG LKQVVASSFW        60
     LVFEFQHFKV GCNAARKFPV NGIANAQPQQ CGTYRSHNGK LSIAIGHFCR IHQRAHTHFA       120
     IAKIAEFNPA VHCHHVVWHL FWRTHLGAIQ LCV                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page