(data stored in ACNUC7421 zone)

EMBL: CP000038.PHOR

CP000038.PHOR        Location/Qualifiers
FT   CDS             402983..404278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="SSON_0377"
FT                   /old_locus_tag="SSO_0377"
FT                   /product="positive and negative sensor protein for pho
FT                   regulon"
FT                   /note="Code: T; COG: COG0642"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87153"
FT                   /db_xref="GOA:Q3Z509"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z509"
FT                   /protein_id="AAZ87153.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEESGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIAKNSD"
     MLERLSWKRL VLELLLCCLP AFILGAFFGY LPWFLLASVT GLLIWHFWNL LRLSWWLWVD        60
     RSMTPPPGRG SWEPLLYGLH QMQLRNKKRR RELGNLIKRF RSGAESLPDA VVLTTEESGI       120
     FWCNGLAQQI LGLRWPEDNG QNILNLLRYP EFTQYLKTRD FSRPLNLVLN TGRHLEIRVM       180
     PYTHKQLLMV ARDVTQMHQL EGARRNFFAN VSHELRTPLT VLQGYLEMMD EQPLEGAVRE       240
     KALHTMREQT QRMEGLVKQL LTLSKIEAAP TQLLNEKVDV PMMLRVVERE AQTLSQKKQT       300
     FTFEIDNGLK VSGNEDQLRS AISNLVYNAV NHTPEGTHIT VRWQRVPHGA EFSVEDNGPG       360
     IAPEHIPRLT ERFYRVDKAR SRQTGGSGLG LAIVKHAVNH HESRLNIEST VGKGTRFSFV       420
     IPERLIAKNS D                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page