(data stored in ACNUC7421 zone)

EMBL: CP000038.PHPB

CP000038.PHPB        Location/Qualifiers
FT   CDS             complement(630666..631190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phpB"
FT                   /locus_tag="SSON_0592"
FT                   /old_locus_tag="SSO_0592"
FT                   /product="PhpB"
FT                   /note="Salmonella cobC-like protein; phosphohistidine
FT                   protein; Code: G; COG: COG0406"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87358"
FT                   /db_xref="GOA:Q3Z4F4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4F4"
FT                   /protein_id="AAZ87358.1"
FT                   /translation="MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGV
FT                   SFDLVLCSELERAQHTARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYS
FT                   AWCNDWQHAIPTNGEGFQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGM
FT                   PAEAMWHFRVD"
     MRLWLIRHGE TQANIDGLYS GHAPTPLTAR GIEQAQNLHT LLHGVSFDLV LCSELERAQH        60
     TARLVLSDRQ LPVQIIPELN EMFFGDWEMR HHRDLMQEDA ENYSAWCNDW QHAIPTNGEG       120
     FQAFSQRVER FIARLSEFQH YQNILVVSHQ GVLSLLIARL IGMPAEAMWH FRVD             174
//

If you have problems or comments...

PBIL Back to PBIL home page