(data stored in ACNUC7421 zone)

EMBL: CP000038.PPDD

CP000038.PPDD        Location/Qualifiers
FT   CDS             complement(126337..126777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="SSON_0116"
FT                   /old_locus_tag="SSO_0116"
FT                   /product="prelipin peptidase dependent protein"
FT                   /note="Code: NU; COG: COG4969"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86910"
FT                   /db_xref="GOA:Q3Z5Q2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Q2"
FT                   /protein_id="AAZ86910.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
     MDKQRGFTLI ELMVVIGIIA ILSAIGIPAY QNYLRKAALT DMLQTFVPYR TAVELCALEH        60
     GGLDTCDGGS NGIPSPTTTR YVSAMSVAKG VVSLTGQESL NGLSVVMTPG WDNANGVTGW       120
     ARNCNIQSDS ALQQACEDVF RFDDAN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page