(data stored in ACNUC7421 zone)

EMBL: CP000038.PRFH

CP000038.PRFH        Location/Qualifiers
FT   CDS             306456..306956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="SSON_0278"
FT                   /old_locus_tag="SSO_0278"
FT                   /product="probable peptide chain release factor"
FT                   /note="Code: J; COG: COG1186"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87061"
FT                   /db_xref="GOA:Q3Z5A1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5A1"
FT                   /protein_id="AAZ87061.1"
FT                   /translation="MLETETGRYSDTLRSALVSLDGDNAWALSESWCGTIQWICPSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRSSGPGGQHVNKTDSAVRATHLASGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
     MLETETGRYS DTLRSALVSL DGDNAWALSE SWCGTIQWIC PSPYRPHHGR KNWFLGIGRF        60
     TADEQEQSDA IRYETLRSSG PGGQHVNKTD SAVRATHLAS GISVKVQSER SQHANKRLAR       120
     LLIAWKLEQQ QQENSAVLKS QRRMFHHQIE RGNPRRTFTG MAFIEG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page