(data stored in ACNUC7421 zone)

EMBL: CP000038.PRIC

CP000038.PRIC        Location/Qualifiers
FT   CDS             complement(482479..483006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="SSON_0454"
FT                   /old_locus_tag="SSO_0454"
FT                   /product="primosomal replication protein N''"
FT                   /note="Code: L; COG: COG3923"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87230"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4T2"
FT                   /protein_id="AAZ87230.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALCHAVEQQQLPQVAWLAEHLAAQLEAIAREASAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     MKTALLLEKL EGQLATLRQR CAPVSQFATL SARFDRHLFQ TRATTLQACL DEAGDNLAAL        60
     CHAVEQQQLP QVAWLAEHLA AQLEAIAREA SAWSLREWDS APPKIARWQR KRIQHQDFER       120
     RLREMVAERR ARLARVTDLV EQQTLHREVE AYEARLARCR HALEKIENRL ARLTR            175
//

If you have problems or comments...

PBIL Back to PBIL home page