(data stored in ACNUC7421 zone)

EMBL: CP000038.PROY

CP000038.PROY        Location/Qualifiers
FT   CDS             406080..407453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="SSON_0379"
FT                   /old_locus_tag="SSO_0379"
FT                   /product="proline permease transport protein"
FT                   /note="Code: E; COG: COG1113"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87155"
FT                   /db_xref="GOA:Q3Z507"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z507"
FT                   /protein_id="AAZ87155.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRCLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
     MESKNKLKRG LSTRHIRFMA LGSAIGTGLF YGSADAIKMA GPSVLLAYII GGIAAYIIMR        60
     ALGEMSVHNP AASSFSRYAQ ENLGPLAGYI TGWTYCFEIL IVAIADVTAF GIYMGVWFPT       120
     VPHWIWVLSV VLIICAVNLM SVKVFGELEF WFSFFKVATI IIMIVAGFGI IIWGIGNGGQ       180
     PTGIHNLWSN GGFFSNGWLG MVMSLQMVMF AYGGIEIIGI TAGEAKDPEK SIPRAINSVP       240
     MRILVFYVGT LFVIMSIYPW NQVGTAGSPF VLTFQHMGIT FAASILNFVV LTASLSAINS       300
     DVFGVGRMLH GMAEQGSAPK IFSKTSRRGI PWVTVLVMTT ALLFAVYLNY IMPENVFLVI       360
     ASLATFATVW VWIMILLSQI AFRRCLPPEE VKALKFKVPG GVATTIGGLI FLLFIIGLIG       420
     YHPDTRISLY VGFAWIVVLL IGWMFKRRHD RQLAENQ                                457
//

If you have problems or comments...

PBIL Back to PBIL home page