(data stored in ACNUC7421 zone)

EMBL: CP000038.TAUA

CP000038.TAUA        Location/Qualifiers
FT   CDS             369257..370276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="SSON_0343"
FT                   /old_locus_tag="SSO_0343"
FT                   /product="taurine transport system periplasmic protein"
FT                   /note="Code: P; COG: COG4521"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87119"
FT                   /db_xref="GOA:Q3Z543"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z543"
FT                   /protein_id="AAZ87119.1"
FT                   /translation="MNVFIPEYCSHNKTGEQTIMAISSRNTLLAALAFIAFQAQAVNVT
FT                   VAYQTSAEPAKVAQADNTFAKESGASVDWRKFDSGASIVRALASGDVQIGNLGSSPLAV
FT                   AASQQVPIEVFLLASKLGNSEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHW
FT                   GIKPGQVEIVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPT
FT                   LDVWVVRKDFAEKHPEVVKAFAKSAIDAQQPYIANPDAWLKQPENISKLARLSGVPEGD
FT                   VPGLVKGNTYLTPQQQTAELTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     MNVFIPEYCS HNKTGEQTIM AISSRNTLLA ALAFIAFQAQ AVNVTVAYQT SAEPAKVAQA        60
     DNTFAKESGA SVDWRKFDSG ASIVRALASG DVQIGNLGSS PLAVAASQQV PIEVFLLASK       120
     LGNSEALVVK KTISKPEDLI GKRIAVPFIS TTHYSLLAAL KHWGIKPGQV EIVNLQPPAI       180
     IAAWQRGDID GAYVWAPAVN ALEKDGKVLT DSEQVGQWGA PTLDVWVVRK DFAEKHPEVV       240
     KAFAKSAIDA QQPYIANPDA WLKQPENISK LARLSGVPEG DVPGLVKGNT YLTPQQQTAE       300
     LTGPVNKAII DTAQFLKEQG KVPAVANDYS QYVTSRFVQ                              339
//

If you have problems or comments...

PBIL Back to PBIL home page