(data stored in ACNUC7421 zone)

EMBL: CP000038.TAUC

CP000038.TAUC        Location/Qualifiers
FT   CDS             371053..371880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="SSON_0345"
FT                   /old_locus_tag="SSO_0345"
FT                   /product="taurine transport system permease protein"
FT                   /note="Code: P; COG: COG0600"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87121"
FT                   /db_xref="GOA:Q3Z541"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z541"
FT                   /protein_id="AAZ87121.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVVIGIPVGIA
FT                   MGLSPTVRGILDPVIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSVLA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
     MSVLINEKLH SRRLKWRWPL SRQVTLSIGT LAVLLTVWWT VAALQLISPL FLPPPQQVLA        60
     KLLTIAGPQG FMDATLWQHL AASLTRIVLA LLAAVVIGIP VGIAMGLSPT VRGILDPVIE       120
     LYRPVPPLAY LPLMVIWFGI GETSKILLIY LAIFAPVAMS VLAGVKSAQQ VRIRAAQSLG       180
     ASRAQVLWFV ILPGALPEIL TGLRIGLGVG WSTLVAAELI AATRGLGFMV QSAGEFLATD       240
     VVLAGIAVIA IIAFLLELGL RALQRRLTPW HGEVQ                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page