(data stored in ACNUC7421 zone)

EMBL: CP000038.TBPA

CP000038.TBPA        Location/Qualifiers
FT   CDS             complement(82281..83264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="SSON_0074"
FT                   /old_locus_tag="SSO_0074"
FT                   /product="thiamin-binding periplasmic protein"
FT                   /note="Code: H; COG: COG4143"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86869"
FT                   /db_xref="GOA:Q3Z5U3"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5U3"
FT                   /protein_id="AAZ86869.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPKIKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFTFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVYPAFQNAIPTGNWM
FT                   YPVANVTQPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     MLKKCLPLLL LCTAPVFAKP VLTVYTYDSF AADWGPGPKI KKAFEADCNC ELKLVALEDG        60
     VSLLNRLRME GKNSKADVVL GLDNNLLDAA SKTGLFAKSG VAADAVNVPG GWNNDTFVPF       120
     DYGYFTFVYD KNKLKNPPQS LKELVESDQN WRVIYQDPRT STPGLGLLLW MQKVYGDDAP       180
     QAWQKLAKKT VTVTKGWSEA YGLFLKGESD LVLSYTTSPA YHILEEKKDN YAAANFSEGH       240
     YLQVEVAART AASKQPELAQ KFLQFMVYPA FQNAIPTGNW MYPVANVTQP AGFEQLTKPA       300
     TTLEFTPAEV AAQRQAWISE WQRAVSR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page