(data stored in ACNUC7421 zone)

EMBL: CP000038.XSEB

CP000038.XSEB        Location/Qualifiers
FT   CDS             complement(426070..426312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SSON_0399"
FT                   /old_locus_tag="SSO_0399"
FT                   /product="exonuclease VII small subunit"
FT                   /note="Code: L; COG: COG1722"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87175"
FT                   /db_xref="GOA:Q3Z4Y7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4Y7"
FT                   /protein_id="AAZ87175.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDTSLPPFTPDNE"
     MPKKNEAPAS FEKALSELEQ IVTRLESGDL PLEEALNEFE RGVQLARQGQ AKLQQAEQRV        60
     QILLSDNEDT SLPPFTPDNE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page