(data stored in ACNUC7421 zone)

EMBL: CP000038.YAAH

CP000038.YAAH        Location/Qualifiers
FT   CDS             complement(10704..11270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="SSON_0011"
FT                   /old_locus_tag="SSO_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1584"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86808"
FT                   /db_xref="GOA:Q3Z604"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z604"
FT                   /protein_id="AAZ86808.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
     MGNTKLANPA PLGLMGFGMT TILLNLHNVG YFALDGIILA MGIFYGGIAQ IFAGLLEYKK        60
     GNTFGLTAFT SYGSFWLTLV AILLMPKLGL TDAPNAQFLG VYLGLWGVFT LFMFFGTLKG       120
     ARVLQFVFFS LTVLFALLAI GNIAGNAAII HFAGWIGLIC GASAIYLAMG EVLNEQFGRT       180
     VLPIGESH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page