(data stored in ACNUC7421 zone)

EMBL: CP000038.YACC

CP000038.YACC        Location/Qualifiers
FT   CDS             complement(145701..146171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="SSON_0130"
FT                   /old_locus_tag="SSO_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86924"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5N8"
FT                   /protein_id="AAZ86924.1"
FT                   /translation="MSIVLPLTGRSSRRHNLIDNNGRRLARSVLTFIFFKPLVEAMKTF
FT                   FRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRALVFFA
FT                   QQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
     MSIVLPLTGR SSRRHNLIDN NGRRLARSVL TFIFFKPLVE AMKTFFRTVL FGSLMAVCAN        60
     SYALSESEAE DMADLTAVFV FLKNDCGYQN LPNGQIRRAL VFFAQQNQWD LSNYDTFDMK       120
     ALGEDSYRDL SGIGIPVAKK CKALARDSLS LLAYVK                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page